Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFBR1/ALK-5, Mouse (HEK293, Fc)

TGFBR1 is a transmembrane kinase that cooperates with TGFBR2 to form the TGF-β receptor complex.This complex is activated by cytokines and regulates a variety of processes, including cell cycle arrest, mesenchymal cell control, wound healing, and carcinogenesis.TGFBR1/ALK-5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TGFBR1/ALK-5 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TGFBR1/ALK-5 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgfbr1-alk-5-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

LQCFCHLCTKDNFTCETDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNKIELPTTGPFSEKQSAGLGPVE

Molecular Formula

21812 (Gene_ID) Q64729 (L30-E125) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZPBP2 (NM_199321) Human Recombinant Protein
TP317396 20 µg

ZPBP2 (NM_199321) Human Recombinant Protein

Sign In for Pricing
View Details
SPTLC1 Human Gene Knockout Kit (CRISPR)
KN416310 1 Kit

SPTLC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AMIGO2 (NM_181847) Human Over-expression Lysate
LC403630 20 µg

AMIGO2 (NM_181847) Human Over-expression Lysate

Sign In for Pricing
View Details
EASYStep Pro Human Carcinoembryonic Antigen (CEA) ELISA Kit
RDEp-CEA-Hu 96 Tests

EASYStep Pro Human Carcinoembryonic Antigen (CEA) ELISA Kit

Sign In for Pricing
View Details
Lysosome Membrane Protein 2 Antibody
KC-7793-01 50 μL

Lysosome Membrane Protein 2 Antibody

Sign In for Pricing
View Details
Lysosome Membrane Protein 2 Antibody
KC-7793-02 100 µL

Lysosome Membrane Protein 2 Antibody

Sign In for Pricing
View Details