Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKG2D/CD314, Mouse (HEK293, His)

The NKG2D/CD314 protein activates and stimulates the innate immune response of NK cells by binding to stress-inducing ligands on tumor and virus-infected cells.It also acts as a costimulatory receptor for TCR, enhancing T cell activation and eliminating tumor cells.NKG2D/CD314 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NKG2D/CD314 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NKG2D/CD314 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nkg2d-cd314-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

FQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV

Molecular Formula

27007 (Gene_ID) O54709 (F94-V232) (Accession)

Molecular Weight

Approximately 20-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-phospho-Survivin (Thr34) antibody
SL12849R-01 50 µL

Rabbit Anti-phospho-Survivin (Thr34) antibody

Sign In for Pricing
View Details
Rabbit Anti-phospho-Survivin (Thr34) antibody
SL12849R-02 100 µL

Rabbit Anti-phospho-Survivin (Thr34) antibody

Sign In for Pricing
View Details
Transcobalamin II (A-5) Alexa Fluor® 680
sc-137017 AF680 200 µg/mL

Transcobalamin II (A-5) Alexa Fluor® 680

Sign In for Pricing
View Details
RPL10, NT (RPL10, DXS648E, QM, 60S ribosomal protein L10, Laminin receptor homolog, Protein QM, Tumor suppressor QM) (Biotin) discontinued
041187-Biotin 200 µL

RPL10, NT (RPL10, DXS648E, QM, 60S ribosomal protein L10, Laminin receptor homolog, Protein QM, Tumor suppressor QM) (Biotin) discontinued

Sign In for Pricing
View Details
27KD Rabbit pAb
MBS9145584-01 0.02 mL

27KD Rabbit pAb

Sign In for Pricing
View Details
27KD Rabbit pAb
MBS9145584-02 0.1 mL

27KD Rabbit pAb

Sign In for Pricing
View Details