Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD137/4-1BB, Rhesus Macaque (HEK293, His)

4-1BB (CD137; TNFRSF9), is a surface glycoprotein, a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily[1]. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment[2]. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells[3]. CD137/4-1BB Protein, Rhesus Macaque (HEK293, His) has 186 amino acids (M1-Q186), produced by HEK293 cells with C-terminal His-tag.

Product Specifications

Product Name Alternative

CD137/4-1BB Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd137-4-1bb-protein-rhesus-macaque-hek293-his.html

Purity

98.0

Smiles

LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQ

Molecular Formula

102127961/708281 (Gene_ID) A9YYE7/F6W5G6 (L24-Q186) (Accession)

Molecular Weight

Approximately 17-23 kDa.

References & Citations

[1]Ye L, et al. CD137, an attractive candidate for the immunotherapy of lung cancer. Cancer Sci. 2020 May;111 (5) :1461-1467.|[2]Jiang P, et al. CD137 promotes bone metastasis of breast cancer by enhancing the migration and osteoclast differentiation of monocytes/macrophages. Theranostics. 2019 May 9;9 (10) :2950-2966.|[3]Geng T, et al. CD137 Signaling Promotes Endothelial Apoptosis by Inhibiting Nrf2 Pathway, and Upregulating NF-κB Pathway. Mediators Inflamm. 2020 Jun 6;2020:4321912.|[4]Kamata-Sakurai M, et al. Antibody to CD137 Activated by Extracellular Adenosine Triphosphate Is Tumor Selective and Broadly Effective In Vivo without Systemic Immune Activation. Cancer Discov. 2021 Jan;11 (1) :158-175.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPT7P5 AAV Vector (Human) (CMV)
43409101 1 µg

SEPT7P5 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rabbit Anti-Human IgG Fc - Alexa Fluor 488
YLF0250-01 100 µL

Rabbit Anti-Human IgG Fc - Alexa Fluor 488

Sign In for Pricing
View Details
Rabbit Anti-Human IgG Fc - Alexa Fluor 488
YLF0250-02 500 µL

Rabbit Anti-Human IgG Fc - Alexa Fluor 488

Sign In for Pricing
View Details
Rabbit Anti-Human IgG Fc - Alexa Fluor 488
YLF0250-03 1 mL

Rabbit Anti-Human IgG Fc - Alexa Fluor 488

Sign In for Pricing
View Details
Recombinant Mouse NCR1/CD335 Protein
MBS9146815-01 0.01 mg

Recombinant Mouse NCR1/CD335 Protein

Sign In for Pricing
View Details
Recombinant Mouse NCR1/CD335 Protein
MBS9146815-02 0.02 mg

Recombinant Mouse NCR1/CD335 Protein

Sign In for Pricing
View Details