Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD137/4-1BB, Rhesus Macaque (HEK293, His)

4-1BB (CD137; TNFRSF9), is a surface glycoprotein, a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily[1]. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment[2]. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells[3]. CD137/4-1BB Protein, Rhesus Macaque (HEK293, His) has 186 amino acids (M1-Q186), produced by HEK293 cells with C-terminal His-tag.

Product Specifications

Product Name Alternative

CD137/4-1BB Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd137-4-1bb-protein-rhesus-macaque-hek293-his.html

Purity

98.0

Smiles

LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQ

Molecular Formula

102127961/708281 (Gene_ID) A9YYE7/F6W5G6 (L24-Q186) (Accession)

Molecular Weight

Approximately 17-23 kDa.

References & Citations

[1]Ye L, et al. CD137, an attractive candidate for the immunotherapy of lung cancer. Cancer Sci. 2020 May;111 (5) :1461-1467.|[2]Jiang P, et al. CD137 promotes bone metastasis of breast cancer by enhancing the migration and osteoclast differentiation of monocytes/macrophages. Theranostics. 2019 May 9;9 (10) :2950-2966.|[3]Geng T, et al. CD137 Signaling Promotes Endothelial Apoptosis by Inhibiting Nrf2 Pathway, and Upregulating NF-κB Pathway. Mediators Inflamm. 2020 Jun 6;2020:4321912.|[4]Kamata-Sakurai M, et al. Antibody to CD137 Activated by Extracellular Adenosine Triphosphate Is Tumor Selective and Broadly Effective In Vivo without Systemic Immune Activation. Cancer Discov. 2021 Jan;11 (1) :158-175.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iomazenil
461384 10.0mg

Iomazenil

Sign In for Pricing
View Details
AMN sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0081606 1.0 µg DNA

AMN sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Ctsc (NM_009982) Mouse Recombinant Protein
PM46231M5 20 µg

Ctsc (NM_009982) Mouse Recombinant Protein

Sign In for Pricing
View Details
NP_TR6JSE50FPA Mouse shRNA Lentiviral Particle (Locus ID 272723)
TL511203V 500 µL Each

NP_TR6JSE50FPA Mouse shRNA Lentiviral Particle (Locus ID 272723)

Sign In for Pricing
View Details
Lentiviral human ARID5A shRNA (UAS) - Lentiviral human ARID5A shRNA (UAS) (100)
GTR15082794 1 Vial

Lentiviral human ARID5A shRNA (UAS) - Lentiviral human ARID5A shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Human ITK (N-GST tag)
Z500183 10 µg

Recombinant Human ITK (N-GST tag)

Sign In for Pricing
View Details