Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 1, Human (His, solution)

Carbonic Anhydrase 1 Protein, Human (His, solution) expresses in E. coli with a His tag at the N-terminus. Carbonic Anhydrase 1 (CA1) expression and CA1-mediated calcification are significantly associated with atherosclerosis (AS) progression[1].

Product Specifications

Product Name Alternative

Carbonic Anhydrase 1 Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-1-protein-human-his.html

Purity

98.0

Smiles

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASFHHHHHH

Molecular Formula

759 (Gene_ID) P00915 (A2-F261) (Accession)

Molecular Weight

25-35 kDa

References & Citations

[1]Lin Yuan, et al. Carbonic Anhydrase 1-Mediated Calcification Is Associated With Atherosclerosis, and Methazolamide Alleviates Its Pathogenesis

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Protein arginine N-methyltransferase 1/PRMT1
orb1906823 50 µg

Recombinant Human Protein arginine N-methyltransferase 1/PRMT1

Sign In for Pricing
View Details
Mouse Monoclonal Zika Virus (SPH2015) NS1 Antibody (10) [Allophycocyanin]
NBP3-05858APC 0.1 mL

Mouse Monoclonal Zika Virus (SPH2015) NS1 Antibody (10) [Allophycocyanin]

Sign In for Pricing
View Details
CEACAM3 Protein, Human, Recombinant (hFc)
TMPK-00144-01 5 µg

CEACAM3 Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
CEACAM3 Protein, Human, Recombinant (hFc)
TMPK-00144-02 10 µg

CEACAM3 Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
CEACAM3 Protein, Human, Recombinant (hFc)
TMPK-00144-03 20 µg

CEACAM3 Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
CEACAM3 Protein, Human, Recombinant (hFc)
TMPK-00144-04 50 µg

CEACAM3 Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details