Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPO Antibody / Lactoperoxidase

Lactoperoxidase is a peroxidase enzyme secreted from mammary, salivary and other mucosal glands including the lungs, bronchii and nose that functions as a natural and the first line of defense against antibacterial and antiviral agents. Lactoperoxidase is a member of the heme peroxidase family of enzymes. In humans, lactoperoxidase is encoded by the LPO gene. This gene encodes a member of the peroxidase family of proteins. The encoded preproprotein is proteolytically processed to generate the mature enzyme. Following its secretion from salivary, mammary, and other mucosal glands, this enzyme catalyzes the generation of the antimicrobial substance hypothiocyanous acid. This gene is present in a gene cluster on chromosome 17. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 1-2 µg/mL, Immunofluorescence (FFPE) : 5 µg/mL

UniProt

P22079

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids MFRLDENYQPWGPEPELPLHTLFFNTWRMVKD from the human protein were used as the immunogen for the LPO antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IF

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the LPO antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This LPO antibody is available for research use only.

Storage Conditions

After reconstitution, the LPO antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the LPO antibody should be determined by the researcher.

Image Legend

Immunofluorescent staining of FFPE human Caco-2 cells with LPO antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat CD150/SLAM Protein (His Tag)
PKSR030210 100 µg

Recombinant Rat CD150/SLAM Protein (His Tag)

Sign In for Pricing
View Details
Mouse Melanoma Cell Adhesion Molecule (MCAM) ELISA Kit
RDR-MCAM-Mu-01 96 Tests

Mouse Melanoma Cell Adhesion Molecule (MCAM) ELISA Kit

Sign In for Pricing
View Details
Mouse Melanoma Cell Adhesion Molecule (MCAM) ELISA Kit
RDR-MCAM-Mu-02 48 Tests

Mouse Melanoma Cell Adhesion Molecule (MCAM) ELISA Kit

Sign In for Pricing
View Details
Orbital Shaker BSOR-107
BSOR-107 1 Unit

Orbital Shaker BSOR-107

Sign In for Pricing
View Details
TGFB2 Polyclonal Antibody
E-AB-62240-01 60 µL

TGFB2 Polyclonal Antibody

Sign In for Pricing
View Details
TGFB2 Polyclonal Antibody
E-AB-62240-02 120 µL

TGFB2 Polyclonal Antibody

Sign In for Pricing
View Details