Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nuclear factor 1 B-type Antibody / NFIB

Nuclear factor 1 B-type is a protein that in humans is encoded by the NFIB gene. The NFIB gene is a part of the NFI gene complex that includes three other genes (NFIA, NFIC and NFIX) . The NFIB gene is a protein coding gene that also serves as a transcription factor. This gene is essential in embryonic development and it works together with its gene complex to initiate tissue differentiation in the fetus. Through knockout experiments, researchers found that mice without the NFIB gene have severely underdeveloped lungs. This mutation does not seem to cause spontaneous abortions because in utero the fetus does not use its lungs for respiration. However, this becomes lethal once the fetus is born and has to take its first breath. It is thought that NFIB plays a role in down regulating the transcription factors TGF-?1 and Shh in normal gestation because they remained high in knockout experiments. The absence of NFIB also leads to insufficient amounts of surfactant being produced which is one reason why the mice cannot breathe once it is born. The knockout experiments demonstrated that NFIB has a significant role in fore-brain development. NFIB is typically found in pontine nuclei of the CNS, the cerebral cortex and the white matter of the brain and without NFIB these areas are dramatically affected.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 1-2 µg/mL, Immunofluorescence (FFPE) : 5 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

O00712

Host

Mouse

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids ELVRVS RTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR from the human protein were used as the immunogen for the Nuclear factor 1 B-type antibody.

Clonality

Monoclonal

Isotype

IgG2b

Clone

4D6E4

Applications

WB, IF, FACS

Purity

Antigen affinity purified

Format

Purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the Nuclear factor 1 B-type antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Nuclear factor 1 B-type antibody is available for research use only.

Storage Conditions

After reconstitution, the Nuclear factor 1 B-type antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Nuclear factor 1 B-type antibody should be determined by the researcher.

Location

Nuclear

Image Legend

Immunofluorescent staining of FFPE human A431 cells with Nuclear factor 1 B-type antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[KO Validated] KIF22 Rabbit pAb
E45R29478N 50 ul

[KO Validated] KIF22 Rabbit pAb

Sign In for Pricing
View Details
UBE4A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2576005 3x 1.0 µg

UBE4A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
EGF Polyclonal Antibody
E44H02095 100 µL

EGF Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti Human LRRC15 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120UL
IRBAMLLRRC15AP78120UL 120 µL

Rabbit Anti Human LRRC15 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120UL

Sign In for Pricing
View Details
Rabbit Polyclonal HSP60 Antibody [Alexa Fluor 405]
NBP1-77396AF405 0.1 mL

Rabbit Polyclonal HSP60 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF
PROTP07200-5ug 5 µg

Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF

Sign In for Pricing
View Details