Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD1 Antibody

MBD1 (Methyl-CpG-Binding Domain Protein 1), also known as PCM1 or CXXC3, is a protein that in humans is encoded by the MBD1 gene. Using PCR on a hybrid panel and FISH, Hendrich et al. (1999) mapped the MBD1 gene to chromosome 18q21, 2.1 cM distal to MBD2. Using yeast 2-hybrid analysis, reciprocal immunoprecipitation analysis, and protein pull-down assays, Fujita et al. (2003) showed that MBD1 interacted directly with MCAF. Deletion analysis revealed that the C-terminal transcriptional repressor domain (TRD) of MBD1 interacted with a conserved C-terminal domain of MCAF. Reporter gene assays showed that MCAF increased the repressive function of the isolated TRD of MBD1 against SP1. Chromatin immunoprecipitation analysis revealed that MBD1 linked MCAF to methylated promoters. Uchimura et al. (2006) found that MBD1 was multiply sumoylated in HeLa cells. Sumoylation did not alter the intracellular localization of MBD1 at nuclear foci in C-33A human cervical cancer cells.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

Q9UIS9

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids DLTLFDFKQGILCYPAPKAHPVAVASKKRK from the human protein were used as the immunogen for the MBD1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, FACS

Purity

Affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the MBD1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This MBD1 antibody is available for research use only.

Storage Conditions

After reconstitution, the MBD1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the MBD1 antibody should be determined by the researcher.

Image Legend

Flow cytometry testing of human A549 cells with MBD1 antibody at 1ug/million cells (blocked with goat sera) ; Red=cells alone, Green=isotype control, Blue= MBD1 antibody.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FH Antibody Blocking Peptide
orb1504656 500 µg

FH Antibody Blocking Peptide

Sign In for Pricing
View Details
Mmu-miR-1843b-3p inhibitor
HY-RI02706-01 5 nmol

Mmu-miR-1843b-3p inhibitor

Sign In for Pricing
View Details
Mmu-miR-1843b-3p inhibitor
HY-RI02706-02 20 nmol

Mmu-miR-1843b-3p inhibitor

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg UPF0266 membrane protein yobD (yobD)
MBS7035287-01 0.02 mg

Recombinant Salmonella heidelberg UPF0266 membrane protein yobD (yobD)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg UPF0266 membrane protein yobD (yobD)
MBS7035287-02 0.1 mg

Recombinant Salmonella heidelberg UPF0266 membrane protein yobD (yobD)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg UPF0266 membrane protein yobD (yobD)
MBS7035287-03 5x 0.1 mg

Recombinant Salmonella heidelberg UPF0266 membrane protein yobD (yobD)

Sign In for Pricing
View Details