Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNPO Antibody / Synaptopodin

The spine apparatus (SA) is a specialized form of endoplasmic reticulum (ER) that is found in a subpopulation of dendritic spines in central neurons. The SA consists of a series of stacked discs that are though to be connected to each other and to the dendritic system of ER-tubules. The actin binding protein synaptopodin (which has originally been described in podocytes of the kidney) is an essential component of the SA. Mice that lack the gene for synaptopodin do not form a spine apparatus. The SA is believed to play a critical role in learning and memory. In summary, an important function of the spine apparatus is the regulation of plasticity at individual synapses, a process known as metaplasticity. The International Radiation Hybrid Mapping Consortium mapped the SYNPO gene to chromosome 5.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry: 1-2 µg/mL, Immunofluorescence: 2-4 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

Q8N3V7

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids EKPKVTPNPDLLDLVQTADEKRRQRDHGEVGMEEE from the human protein were used as the immunogen for the SYNPO antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, IF, FACS

Purity

Affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the SYNPO antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This SYNPO antibody is available for research use only.

Storage Conditions

After reconstitution, the SYNPO antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the SYNPO antibody should be determined by the researcher.

Image Legend

Immunofluorescent staining of FFPE human U-2 OS cells with SYNPO antibody (red) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LZTS2 activation kit by CRISPRa
GA113550 1 Kit

Human LZTS2 activation kit by CRISPRa

Sign In for Pricing
View Details
Ahr Mouse Gene Knockout Kit (CRISPR)
KN301012BN 1 Kit

Ahr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DRP2 (NM_001939) Human Over-expression Lysate
LY419641 100 µg

DRP2 (NM_001939) Human Over-expression Lysate

Sign In for Pricing
View Details
DOPA Decarboxylase (DDC) (NM_001082971) Human Over-expression Lysate
LC421202 20 µg

DOPA Decarboxylase (DDC) (NM_001082971) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc35a1 Mouse Gene Knockout Kit (CRISPR)
KN516054 1 Kit

Slc35a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Soft tissue
CS622748 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details