Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITX2 Antibody

Paired-like homeodomain transcription factor 2 also known as pituitary homeobox 2 is a protein that in humans is encoded by the PITX2 gene. It is mapped to 4q25. This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.25-0.5 µg/mL

UniProt

Q99697

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids METNCRKLVSACVQLGVQPAAVECLFSKDSEIKK were used as the immunogen for the PITX2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the PITX2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PITX2 antibody is available for research use only.

Storage Conditions

After reconstitution, the PITX2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PITX2 antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) Caco-2, 2) HEK293, 3) U-2 OS, 4) HeLa, 5) A549, 6) U-87 MG, 7) rat heart and 8) mouse RAW264.7 lysate with PITX2 antibody. Predicted molecular weight ~35 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGTA tetrasodium salt
FE35296-01 1 g

EGTA tetrasodium salt

Sign In for Pricing
View Details
EGTA tetrasodium salt
FE35296-02 2 g

EGTA tetrasodium salt

Sign In for Pricing
View Details
EGTA tetrasodium salt
FE35296-03 5 g

EGTA tetrasodium salt

Sign In for Pricing
View Details
EGTA tetrasodium salt
FE35296-04 10 g

EGTA tetrasodium salt

Sign In for Pricing
View Details
EGTA tetrasodium salt
FE35296-05 500 g

EGTA tetrasodium salt

Sign In for Pricing
View Details
Rat Monoclonal DPPIV/CD26 Antibody (222113) [PerCP]
FAB1180C 0.1 mL

Rat Monoclonal DPPIV/CD26 Antibody (222113) [PerCP]

Sign In for Pricing
View Details