Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCUR1 Antibody / Mitochondrial calcium uniporter regulator 1

MCUR1 is an inner mitochondrial membrane protein that has been shown to function as a component of the mitochondrial Ca (2+) uniporter, in the assembly of mitochondrial respiratory complex IV, and in mitochondrial permeability transition (MPT) . The MCUR1 gene is mapped to chromosome 6p23 based on an alignment of the MCUR1 sequence with the genomic sequence.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL

UniProt

Q96AQ8

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE from the human protein were used as the immunogen for the MCUR1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the MCUR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This MCUR1 antibody is available for research use only.

Storage Conditions

After reconstitution, the MCUR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the MCUR1 antibody should be determined by the researcher.

Location

Cytoplasmic

Image Legend

Western blot testing of human 1) HeLa, 2) MDA-MB-231, 3) HL-60, 4) MDA-MB-453, 5) A431, 6) Caco-2, 7) rat spleen, 8) mouse lung and 9) mouse ANA-1 lysate with MCUR1 antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.
More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL7AP25 3'UTR GFP Stable Cell Line
TU070518 1.0 mL

RPL7AP25 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RNF217, NT (RNF217, C6orf172, IBRDC1, Probable E3 ubiquitin-protein ligase RNF217, IBR domain-containing protein 1, RING finger protein 217) (MaxLight 490)
MBS6342836-01 0.1 mL

RNF217, NT (RNF217, C6orf172, IBRDC1, Probable E3 ubiquitin-protein ligase RNF217, IBR domain-containing protein 1, RING finger protein 217) (MaxLight 490)

Sign In for Pricing
View Details
RNF217, NT (RNF217, C6orf172, IBRDC1, Probable E3 ubiquitin-protein ligase RNF217, IBR domain-containing protein 1, RING finger protein 217) (MaxLight 490)
MBS6342836-02 5x 0.1 mL

RNF217, NT (RNF217, C6orf172, IBRDC1, Probable E3 ubiquitin-protein ligase RNF217, IBR domain-containing protein 1, RING finger protein 217) (MaxLight 490)

Sign In for Pricing
View Details
Bovine Platelet Factor 4 ELISA Kit
MBS035604-01 48 Well

Bovine Platelet Factor 4 ELISA Kit

Sign In for Pricing
View Details
Bovine Platelet Factor 4 ELISA Kit
MBS035604-02 96 Well

Bovine Platelet Factor 4 ELISA Kit

Sign In for Pricing
View Details
Bovine Platelet Factor 4 ELISA Kit
MBS035604-03 5x 96 Well

Bovine Platelet Factor 4 ELISA Kit

Sign In for Pricing
View Details