Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCUR1 Antibody / Mitochondrial calcium uniporter regulator 1

MCUR1 is an inner mitochondrial membrane protein that has been shown to function as a component of the mitochondrial Ca (2+) uniporter, in the assembly of mitochondrial respiratory complex IV, and in mitochondrial permeability transition (MPT) . The MCUR1 gene is mapped to chromosome 6p23 based on an alignment of the MCUR1 sequence with the genomic sequence.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL

UniProt

Q96AQ8

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE from the human protein were used as the immunogen for the MCUR1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the MCUR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This MCUR1 antibody is available for research use only.

Storage Conditions

After reconstitution, the MCUR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the MCUR1 antibody should be determined by the researcher.

Location

Cytoplasmic

Image Legend

Western blot testing of human 1) HeLa, 2) MDA-MB-231, 3) HL-60, 4) MDA-MB-453, 5) A431, 6) Caco-2, 7) rat spleen, 8) mouse lung and 9) mouse ANA-1 lysate with MCUR1 antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Chikungunya virus (CHIKV) (strain SL-CK1) E2 / Envelope 2 Protein (His Tag)
PO55173I2 100 µg

Chikungunya virus (CHIKV) (strain SL-CK1) E2 / Envelope 2 Protein (His Tag)

Sign In for Pricing
View Details
Mouse Exosc4 Pre-designed siRNA Set B
SI104518B 1 Each

Mouse Exosc4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
LAT2, ID (LAT2, LAB, NTAL, WBS15, WBSCR15, WBSCR5, Linker for activation of T-cells family member 2, Linker for activation of B Cells, Membrane-associated adapter molecule, Non-T-cell activation linker, Williams-Beuren syndrome chromosomal region 15 protein, Williams-Beuren syndrome chromosomal region 5 protein) (APC) discontinued
037689-APC 200 µL

LAT2, ID (LAT2, LAB, NTAL, WBS15, WBSCR15, WBSCR5, Linker for activation of T-cells family member 2, Linker for activation of B Cells, Membrane-associated adapter molecule, Non-T-cell activation linker, Williams-Beuren syndrome chromosomal region 15 protein, Williams-Beuren syndrome chromosomal region 5 protein) (APC) discontinued

Sign In for Pricing
View Details
Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B) Antibody (FITC)
abx311406-01 20 µg

Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B) Antibody (FITC)

Sign In for Pricing
View Details
Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B) Antibody (FITC)
abx311406-02 50 µg

Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B) Antibody (FITC)

Sign In for Pricing
View Details
Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B) Antibody (FITC)
abx311406-03 100 µg

Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B) Antibody (FITC)

Sign In for Pricing
View Details