Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-17D, Human (His)

IL-17D protein acts as a potent inducer, effectively triggering endothelial cells to express key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF. The ability of this cytokine to stimulate the production of pro-inflammatory signals emphasizes its importance in orchestrating immune responses, particularly in the context of endothelial cell activation. Animal-Free IL-17D Protein, Human (His) is the recombinant human-derived animal-FreeIL-17D protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-17D Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-17d-protein-human-his.html

Purity

95.0

Smiles

APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP

Molecular Formula

53342 (Gene_ID) Q8TAD2 (A18-P202) (Accession)

Molecular Weight

Approximately 17-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LARP1B Rabbit pAb
E45R19821N-50 50 µL

LARP1B Rabbit pAb

Sign In for Pricing
View Details
TFF1 (57-84) Mouse Monoclonal Antibody [Clone ID: GE2 (same as R47/94)]
AM33297PU-T 20 µg

TFF1 (57-84) Mouse Monoclonal Antibody [Clone ID: GE2 (same as R47/94)]

Sign In for Pricing
View Details
API5 Antibody : Biotin (OAAF02826-Biotin)
OAAF02826-100UG-Biotin 100 µg

API5 Antibody : Biotin (OAAF02826-Biotin)

Sign In for Pricing
View Details
BUN Assay Kit (Visible Spectrophotometry)
CB0037V 50 Tests

BUN Assay Kit (Visible Spectrophotometry)

Sign In for Pricing
View Details
POLR2K CRISPR/Cas9 KO Plasmid (h)
sc-417268 20 µg

POLR2K CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human Thioredoxin2 Protein
ARP4191-01 10 µg

Recombinant Human Thioredoxin2 Protein

Sign In for Pricing
View Details