Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-17D, Human (His)

IL-17D protein acts as a potent inducer, effectively triggering endothelial cells to express key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF. The ability of this cytokine to stimulate the production of pro-inflammatory signals emphasizes its importance in orchestrating immune responses, particularly in the context of endothelial cell activation. Animal-Free IL-17D Protein, Human (His) is the recombinant human-derived animal-FreeIL-17D protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-17D Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-17d-protein-human-his.html

Purity

95.0

Smiles

APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP

Molecular Formula

53342 (Gene_ID) Q8TAD2 (A18-P202) (Accession)

Molecular Weight

Approximately 17-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZNF324 Antibody [FITC]
NBP1-78183F 0.1 mL

Rabbit Polyclonal ZNF324 Antibody [FITC]

Sign In for Pricing
View Details
Human FoxM1 Affinity Purified Polyclonal Ab
AF3975 100 µg

Human FoxM1 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
NSF Protein Vector (Human) (pPB-N-His)
PV105103 500 ng

NSF Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral mouse Prrt4 shRNA (UAS) - Lentiviral mouse Prrt4 shRNA (UAS) (100)
GTR15234882 1 Vial

Lentiviral mouse Prrt4 shRNA (UAS) - Lentiviral mouse Prrt4 shRNA (UAS) (100)

Sign In for Pricing
View Details
GPR182 Antibody (YA7484, Rabbit)
HY-P87799 1 Each

GPR182 Antibody (YA7484, Rabbit)

Sign In for Pricing
View Details
P23 (PTGES3) Mouse Monoclonal Antibody [Clone ID: LBI4C10]
AMM15983VCF 100 µg

P23 (PTGES3) Mouse Monoclonal Antibody [Clone ID: LBI4C10]

Sign In for Pricing
View Details