Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thrombopoietin Antibody / THPO

Thrombopoietin (THPO), also known as megakaryocyte growth and development factor (MGDF), is a protein that in humans is encoded by the THPO gene. Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P40225

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids DFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQL were used as the immunogen for the Thrombopoietin antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the Thrombopoietin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Thrombopoietin antibody is available for research use only.

Storage Conditions

After reconstitution, the Thrombopoietin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Thrombopoietin antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) human HepG2, 2) human Caco-2, 3) rat liver and 4) mouse liver lysate with Thrombopoietin antibody at 0.5ug/ml. Predicted molecular weight: 38 kDa, routinely observed at 40-55 kDa (unmodified), 80-95 kDa (glycosylated) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR7156 Human qPCR Primer Pair (MI0023616)
HP301516 200 Reactions

MIR7156 Human qPCR Primer Pair (MI0023616)

Sign In for Pricing
View Details
SUZ12 Mouse Monoclonal Antibody [Clone ID: 2C11]
AM06556SU-N 100 µL

SUZ12 Mouse Monoclonal Antibody [Clone ID: 2C11]

Sign In for Pricing
View Details
Human Cadherin 6 (CDH6) ELISA Kit
RDR-CDH6-Hu-01 96 Tests

Human Cadherin 6 (CDH6) ELISA Kit

Sign In for Pricing
View Details
Human Cadherin 6 (CDH6) ELISA Kit
RDR-CDH6-Hu-02 48 Tests

Human Cadherin 6 (CDH6) ELISA Kit

Sign In for Pricing
View Details
Human GIMAP2 activation kit by CRISPRa
GA108782 1 Kit

Human GIMAP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Dipeptidyl Peptidase 9 (DPP9) ELISA Kit
RDR-DPP9-Mu-01 96 Tests

Mouse Dipeptidyl Peptidase 9 (DPP9) ELISA Kit

Sign In for Pricing
View Details