Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOG Antibody / Myelin Oligodendrocyte Glycoprotein

Myelin oligodendrocyte glycoprotein (MOG) is a glycoprotein believed to be important in the myelination of nerves in the central nervous system (CNS) . In humans this protein is encoded by the MOG gene. This gene is mapped to 6p22.1. It is speculated to serve as a necessary adhesion molecule to provide structural integrity to the myelin sheath and is known to develop late on the oligodendrocyte. The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Flow cytometry: 1-3ug/10^6 cells

UniProt

Q16653

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK were used as the immunogen for the MOG antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the MOG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This MOG antibody is available for research use only.

Storage Conditions

After reconstitution, the MOG antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the MOG antibody should be determined by the researcher.

Location

Plasma membrane

Image Legend

Western blot testing of 1) rat brain and 2) mouse brain lysate with MOG antibody at 0.5ug/ml. Expected molecular weight: 15-28 kDa depending on glycosylation level.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ptges3 shRNA (UAS) - Lentiviral mouse Ptges3 shRNA (UAS, RFP) (25)
GTR15252419 1 Vial

Lentiviral mouse Ptges3 shRNA (UAS) - Lentiviral mouse Ptges3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rabbit Monoclonal PTH Antibody (PTH/2295R) [DyLight 650]
NBP2-79894C 0.1 mL

Rabbit Monoclonal PTH Antibody (PTH/2295R) [DyLight 650]

Sign In for Pricing
View Details
B-Cell Activating Factor (BAFF) BioAssayTM ELISA Kit (Rat)
023646 96 Tests

B-Cell Activating Factor (BAFF) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
Ubiquitin-like 3
338917 100 µL

Ubiquitin-like 3

Sign In for Pricing
View Details
USF1 (Upstream Stimulatory Factor 1, Class B Basic Helix-loop-helix Protein 11, bHLHb11, Major Late Transcription Factor 1, USF) (MaxLight 650)
MBS6398147-01 0.1 mL

USF1 (Upstream Stimulatory Factor 1, Class B Basic Helix-loop-helix Protein 11, bHLHb11, Major Late Transcription Factor 1, USF) (MaxLight 650)

Sign In for Pricing
View Details
USF1 (Upstream Stimulatory Factor 1, Class B Basic Helix-loop-helix Protein 11, bHLHb11, Major Late Transcription Factor 1, USF) (MaxLight 650)
MBS6398147-02 5x 0.1 mL

USF1 (Upstream Stimulatory Factor 1, Class B Basic Helix-loop-helix Protein 11, bHLHb11, Major Late Transcription Factor 1, USF) (MaxLight 650)

Sign In for Pricing
View Details