Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOG Antibody / Myelin Oligodendrocyte Glycoprotein

Myelin oligodendrocyte glycoprotein (MOG) is a glycoprotein believed to be important in the myelination of nerves in the central nervous system (CNS) . In humans this protein is encoded by the MOG gene. This gene is mapped to 6p22.1. It is speculated to serve as a necessary adhesion molecule to provide structural integrity to the myelin sheath and is known to develop late on the oligodendrocyte. The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Flow cytometry: 1-3ug/10^6 cells

UniProt

Q16653

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK were used as the immunogen for the MOG antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the MOG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This MOG antibody is available for research use only.

Storage Conditions

After reconstitution, the MOG antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the MOG antibody should be determined by the researcher.

Location

Plasma membrane

Image Legend

Western blot testing of 1) rat brain and 2) mouse brain lysate with MOG antibody at 0.5ug/ml. Expected molecular weight: 15-28 kDa depending on glycosylation level.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Rsk-1 Antibody
B0537-01 50 μL

Rsk-1 Antibody

Sign In for Pricing
View Details
Rsk-1 Antibody
B0537-02 100 µL

Rsk-1 Antibody

Sign In for Pricing
View Details
Tygon® Microbore Tube F-4040-A, ID = 2.54, Length = 10 m
1462573 10 PCKS

Tygon® Microbore Tube F-4040-A, ID = 2.54, Length = 10 m

Sign In for Pricing
View Details
SDF2, ID (Stromal cell-derived factor 2, SDF2, ) (MaxLight 550) discontinued
041492-ML550 100 µL

SDF2, ID (Stromal cell-derived factor 2, SDF2, ) (MaxLight 550) discontinued

Sign In for Pricing
View Details
LSM7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1241405 3x 1.0 µg

LSM7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Neutrophil Activating Protein 3 (NAP3)
MBS2035766-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Neutrophil Activating Protein 3 (NAP3)

Sign In for Pricing
View Details