Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOG Antibody / Myelin Oligodendrocyte Glycoprotein

Myelin oligodendrocyte glycoprotein (MOG) is a glycoprotein believed to be important in the myelination of nerves in the central nervous system (CNS) . In humans this protein is encoded by the MOG gene. This gene is mapped to 6p22.1. It is speculated to serve as a necessary adhesion molecule to provide structural integrity to the myelin sheath and is known to develop late on the oligodendrocyte. The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Flow cytometry: 1-3ug/10^6 cells

UniProt

Q16653

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK were used as the immunogen for the MOG antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the MOG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This MOG antibody is available for research use only.

Storage Conditions

After reconstitution, the MOG antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the MOG antibody should be determined by the researcher.

Location

Plasma membrane

Image Legend

Western blot testing of 1) rat brain and 2) mouse brain lysate with MOG antibody at 0.5ug/ml. Expected molecular weight: 15-28 kDa depending on glycosylation level.
More Discoveries

Explore Other Products

Browse additional items from our catalog

HMHB1 rabbit pAb
UB-GEN-9209 100 µL

HMHB1 rabbit pAb

Sign In for Pricing
View Details
CTGE5 rabbit pAb
UB-GEN-10869 100 µL

CTGE5 rabbit pAb

Sign In for Pricing
View Details
IVL Protein Vector (Rat) (pPB-N-His)
PV275303 500 ng

IVL Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
CFH Protein (N-His, Mus musculus (Mouse) )
P502478 100 µg

CFH Protein (N-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details
CD44V6 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (Biotin) discontinued
C2398-94A-Biotin 100 µL

CD44V6 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (Biotin) discontinued

Sign In for Pricing
View Details
Lentiviral human GIPC2 sgRNA gene knockout kit - Lentiviral human GIPC2 sgRNA gene knockout kit (25)
GTR15359406 1 Vial

Lentiviral human GIPC2 sgRNA gene knockout kit - Lentiviral human GIPC2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details