Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAS1 Antibody / Hyaluronan synthase 1

Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Immunofluorescence/Immunocytochemistry: 2-4 µg/mL

UniProt

Q92839

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA were used as the immunogen for the HAS1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, IF/ICC

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the HAS1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This HAS1 antibody is available for research use only.

Storage Conditions

After reconstitution, the HAS1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the HAS1 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) human SHG-44, 2) human ThP-1, 3) rat brain, 4) rat smooth muscle, 5) rat ovary, 6) mouse brain, 7) mouse smooth muscle, 8) mouse ovary, 9) mouse small intestine and 10) mouse Neuro-2a lysate with HAS1 antibody at 0.5ug/ml. Predicted molecular weight ~63 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]
TA802877AM 100 µL

MRPS11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]

Sign In for Pricing
View Details
HOXD9 Mouse Monoclonal Antibody [Clone ID: OTI2B1]
CF809665 100 µg

HOXD9 Mouse Monoclonal Antibody [Clone ID: OTI2B1]

Sign In for Pricing
View Details
1,2-Benzenedicarboxylic Acid 1-(10-Hydroxyundecyl) Ester
TRC-B488585-25MG 25 mg

1,2-Benzenedicarboxylic Acid 1-(10-Hydroxyundecyl) Ester

Sign In for Pricing
View Details
Guvacoline Hydrochloride
TRC-G876510-10MG 10 mg

Guvacoline Hydrochloride

Sign In for Pricing
View Details
Mitochondrial Marker (MTC02), CF647 conjugate, 0.1mg/mL
BNC470740-500 1x 500 µL

Mitochondrial Marker (MTC02), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (FN1) Rabbit Polyclonal Antibody
AP06602PU-N 100 µg

Fibronectin (FN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details