Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD272 Antibody / BTLA

B- and T-lymphocyte attenuator is a protein that in humans is encoded by the BTLA gene. BTLA has also been designated as CD272 (cluster of differentiation 272) . This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. BTLA expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 and CTLA4, BTLA interacts with a B7 homolog, B7H4.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL, FACS: 1-3ug/10^6 cells

UniProt

Q7Z6A9

Host

Rabbit

Reactivity

Human, Mouse

Immunogen

Amino acids QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL were used as the immunogen for the CD272 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the CD272 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This CD272 antibody is available for research use only.

Storage Conditions

After reconstitution, the CD272 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the CD272 antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HEK293, 2) Jurkat, 3) CCRF-CEM and 4) mouse thymus lysate with CD272 antibody at 0.5ug/ml. Predicted molecular weight: 33-60 kDa depending on level of glycosylation.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stard13 3'UTR Luciferase Stable Cell Line
TU221271 1.0 mL

Stard13 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Stub1 Mouse Pre-designed siRNA Set A
HY-RS17083 1 Set

Stub1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
AIMP2 Polyclonal Antibody, Cy7 Conjugated
bs-2509R-Cy7-TR 20 µL

AIMP2 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
TK1 (Thymidine Kinase 1, Soluble, TK2) (APC)
MBS6168665-01 0.1 mL

TK1 (Thymidine Kinase 1, Soluble, TK2) (APC)

Sign In for Pricing
View Details
TK1 (Thymidine Kinase 1, Soluble, TK2) (APC)
MBS6168665-02 5x 0.1 mL

TK1 (Thymidine Kinase 1, Soluble, TK2) (APC)

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SLC22A12
MBS8596735-01 0.1 mL

Mouse Monoclonal Antibody to SLC22A12

Sign In for Pricing
View Details