Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51 Antibody / RAD51A

DNA repair protein RAD51 homolog 1, also known as RAD51A, is a human gene. The Rad51 gene, HsRAD51, is a homolog of RecA of Escherichia coli and functions in recombination and DNA repair. BRCA1 and BRCA2 proteins form a complex with Rad51, and these genes are thought to participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51 is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Immunofluorescence (FFPE) : 2-4 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

Q06609

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK were used as the immunogen for the RAD51 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, IF, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the RAD51 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Storage Conditions

After reconstitution, the RAD51 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the RAD51 antibody should be determined by the researcher.

Image Legend

IHC staining of FFPE human testis with RAD51 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal FANCD2 Antibody (1290D) [Alexa Fluor 405]
NBP2-54808AF405 0.1 mL

Rabbit Monoclonal FANCD2 Antibody (1290D) [Alexa Fluor 405]

Sign In for Pricing
View Details
DDX4 Mouse Monoclonal Antibody [Clone:1G7]
E45M21175 100 µg

DDX4 Mouse Monoclonal Antibody [Clone:1G7]

Sign In for Pricing
View Details
TCF7L2 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-1280R-APC-Cy5.5 100 µL

TCF7L2 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae caiA Protein (aa 1-380)
VAng-Lsx06782-50gEcoli 50 µg (E. coli)

Recombinant Shigella Dysenteriae caiA Protein (aa 1-380)

Sign In for Pricing
View Details
SLC2A11 Human shRNA Lentiviral Particle (Locus ID 66035)
TL301612V 500 µL Each

SLC2A11 Human shRNA Lentiviral Particle (Locus ID 66035)

Sign In for Pricing
View Details
Small proline-rich protein 3 Antibody (APC)
orb3165449 100 µg

Small proline-rich protein 3 Antibody (APC)

Sign In for Pricing
View Details