Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELAVL2 Antibody / HUB

ELAV-like protein 2 is a protein that in humans is encoded by the ELAVL2 gene. This gene encodes a member of the cytochrome P450 superfamily of enzymes, and is commonly known as sterol 27-hydroxylase. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL

UniProt

Q12926

Host

Rabbit

Reactivity

Human, Mouse

Immunogen

Amino acids METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK were used as the immunogen for the ELAVL2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the ELAVL2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Storage Conditions

After reconstitution, the ELAVL2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the ELAVL2 antibody should be determined by the researcher.

Location

Nuclear, cytoplasmic

Image Legend

Western blot testing of human 1) T-47D, 2) A549 and 3) Caco-2 lysate with ELAVL2 antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASL Rabbit pAb
orb2719134-01 50 µL

ASL Rabbit pAb

Sign In for Pricing
View Details
ASL Rabbit pAb
orb2719134-02 100 µL

ASL Rabbit pAb

Sign In for Pricing
View Details
Transforming Growth Factor (α (TGFA) Sheep ELISA Kit
H7700 96 Tests

Transforming Growth Factor (α (TGFA) Sheep ELISA Kit

Sign In for Pricing
View Details
PRR20B Recombinant Protein (Human)
RP085089 100 µg

PRR20B Recombinant Protein (Human)

Sign In for Pricing
View Details
AVPR1A, CT (AVPR1A, AVPR1, Vasopressin V1a receptor, AVPR V1a, Antidiuretic hormone receptor 1a, Vascular/hepatic-type arginine vasopressin receptor)
032336 200 µL

AVPR1A, CT (AVPR1A, AVPR1, Vasopressin V1a receptor, AVPR V1a, Antidiuretic hormone receptor 1a, Vascular/hepatic-type arginine vasopressin receptor)

Sign In for Pricing
View Details
Human Mumps Virus (MuV) IgM ELISA Kit
MBS2548667-01 24 Strip Well

Human Mumps Virus (MuV) IgM ELISA Kit

Sign In for Pricing
View Details