Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELAVL2 Antibody / HUB

ELAV-like protein 2 is a protein that in humans is encoded by the ELAVL2 gene. This gene encodes a member of the cytochrome P450 superfamily of enzymes, and is commonly known as sterol 27-hydroxylase. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL

UniProt

Q12926

Host

Rabbit

Reactivity

Human, Mouse

Immunogen

Amino acids METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK were used as the immunogen for the ELAVL2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the ELAVL2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Storage Conditions

After reconstitution, the ELAVL2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the ELAVL2 antibody should be determined by the researcher.

Location

Nuclear, cytoplasmic

Image Legend

Western blot testing of human 1) T-47D, 2) A549 and 3) Caco-2 lysate with ELAVL2 antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CHPF shRNA (UAS) - Lentiviral human CHPF shRNA (UAS, RFP) (25)
GTR15112199 1 Vial

Lentiviral human CHPF shRNA (UAS) - Lentiviral human CHPF shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human UXT Pre-designed siRNA Set B
SI017983B 1 Each

Human UXT Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mmu-miR-1968-3p miRNA Agomir
orb1917950-01 5 nmol

Mmu-miR-1968-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-1968-3p miRNA Agomir
orb1917950-02 10 nmol

Mmu-miR-1968-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-1968-3p miRNA Agomir
orb1917950-03 20 nmol

Mmu-miR-1968-3p miRNA Agomir

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Fibrillarin (FBL)
MBS2066109-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Fibrillarin (FBL)

Sign In for Pricing
View Details