Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP5 Antibody / Aquaporin 5

Aquaporin 5, also known as AQP5, is a water channel protein. The aquaporins (AQPs) are a family of more than 10 homologous water transporting proteins expressed in many mammalian epithelia and endothelia. At least five AQPs are expressed in the eye: AQP0 (MIP) in lens fiber, AQP1 in cornea endothelium, ciliary and lens epithelia and trabecular meshwork, AQP3 in conjunctiva, AQP4 in ciliary epithelium and retinal M�ller cells, and AQP5 in corneal and lacrimal gland epithelia. Among the seven human aquaporins cloned to date (AQPs 0-6), genes encoding the four most closely related aquaporins (AQP0, AQP2, AQP5, and AQP6) have been mapped to chromosome band 12q13, suggesting an aquaporin family gene cluster at this locus. Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL

UniProt

P55064

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

Amino acids NSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR were used as the immunogen for the AQP5 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the AQP5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This AQP5 antibody is available for research use only.

Storage Conditions

After reconstitution, the AQP5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the AQP5 antibody should be determined by the researcher.

Location

Plasma membrane

Image Legend

IHC staining of FFPE mouse lung with AQP5 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell adhesion molecuLe 4 (CADM4) (NM_145296) Human Tagged ORF Clone Lentiviral Particle
RC213683L1V 200 µL

Cell adhesion molecuLe 4 (CADM4) (NM_145296) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Vmn1r220 Protein Vector (Mouse) (pPB-C-His)
PV245578 500 ng

Vmn1r220 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas atlantica UPF0391 membrane protein Patl_4137 (Patl_4137), partial
MBS7073657 Inquire

Recombinant Pseudoalteromonas atlantica UPF0391 membrane protein Patl_4137 (Patl_4137), partial

Sign In for Pricing
View Details
SLC44A1 (Solute Carrier Family 44, Member 1, CD92, CDW92, CHTL1, CTL1, RP11-287A8.1) (MaxLight 550)
251757-ML550 100 µL

SLC44A1 (Solute Carrier Family 44, Member 1, CD92, CDW92, CHTL1, CTL1, RP11-287A8.1) (MaxLight 550)

Sign In for Pricing
View Details
C7orf36 Antibody (Center) Blocking peptide
MBS9219840-01 0.5 mg

C7orf36 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
C7orf36 Antibody (Center) Blocking peptide
MBS9219840-02 5x 0.5 mg

C7orf36 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details