Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM16A Antibody / DOG1 / ANO1

Anoctamin-1 (ANO1), also known as oral cancer overexpressed 2 (ORAOV2) or tumor-amplified and overexpressed sequence 2 (TMEM16A), is a protein that in humans is encoded by the ANO1 gene. This gene belongs to a family of membrane proteins containing 8 transmembrane segments, and it is mapped to 11q13.3. TMEM16A is a candidate calcium-activated chloride channel that mediates receptor-activated chloride currents in diverse physiologic processes, and it is thought to be responsible for a voltage-sensitive calcium-activated chloride current. Its overexpression was reported in esophageal squamous cell carcinoma and breast cancer progression Crofelemer, an antidiarrhoeal, inhibits this channel. TMEM16A has eight transmembrane domains, its pore is large and non-selective, allowing other negatively charged species to permeate.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

Q5XXA6

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids QQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDE were used as the immunogen for the TMEM16A antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the TMEM16A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This TMEM16A antibody is available for research use only.

Storage Conditions

After reconstitution, the TMEM16A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the TMEM16A antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HeLa, 2) HepG2, 3) A549, 4) PANC-1, 5) SK-OV-3, 6) SGC-7901 and 7) COLO-320 lysate with TMEM16A antibody at 0.5ug/ml. Expected molecular weight 74-114 kDa but may be observed at higher molecular weights due to glycosylation.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Skin
CS624739 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
Mouse Bmp6 activation kit by CRISPRa
GA200421 1 Kit

Mouse Bmp6 activation kit by CRISPRa

Sign In for Pricing
View Details
IRE1 (ERN1) (NM_001433) Human Over-expression Lysate
LY419940 100 µg

IRE1 (ERN1) (NM_001433) Human Over-expression Lysate

Sign In for Pricing
View Details
SFRS8 (SFSWAP) (N-term) Rabbit Polyclonal Antibody
AP53882PU-N 400 µL

SFRS8 (SFSWAP) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human COMMD7 activation kit by CRISPRa
GA115725 1 Kit

Human COMMD7 activation kit by CRISPRa

Sign In for Pricing
View Details
Human CaMKI gamma (CAMK1G) activation kit by CRISPRa
GA111425 1 Kit

Human CaMKI gamma (CAMK1G) activation kit by CRISPRa

Sign In for Pricing
View Details