Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHR Antibody / Aryl Hydrocarbon Receptor

AHR (Aryl Hydrocarbon Receptor), also called bHLHe76, is a member of the family of basic helix-loop-helix transcription factors. AhR is a cytosolic transcription factor that is normally inactive, bound to several co-chaperones. The AHR gene is mapped on 7p21.1. Estrogenic actions of AHR agonists were detected in wildtype ovariectomized mouse uteri, but were absent in Ahr -/- or Er-alpha -/- ovariectomized mice. Complex assembly and ubiquitin ligase activity of CUL4B (AHR) in vitro and in vivo are dependent on the AHR ligand. In the CUL4B (AHR) complex, ligand-activated AHR acts as a substrate-specific adaptor component that targets sex steroid receptors for degradation. Cd4-positive cells from mice lacking Ahr developed Th17 responses but failed to produce Il22 and did not show enhanced Th17 development. Activation of Ahr during induction of EAE accelerated disease onset and increased pathology in wildtype mice, but not in Ahr -/- mice. The TDO-AHR pathway is active in human brain tumors and is associated with malignant progression and poor survival. Ahr activity within ROR-gamma-t-positive ILC could be induced by dietary ligands such as those contained in vegetables of the family Brassicaceae.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, FACS: 1-3ug/10^6 cells

UniProt

P35869

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH were used as the immunogen for the AHR antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the AHR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This AHR antibody is available for research use only.

Storage Conditions

After reconstitution, the AHR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the AHR antibody should be determined by the researcher.

Location

Cytoplasmic, nuclear

Image Legend

IHC staining of FFPE human esophagus squamous cancer with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KC1 Mouse Monoclonal Antibody [Clone ID: OTI10F11]
CF808825 100 µg

RPS6KC1 Mouse Monoclonal Antibody [Clone ID: OTI10F11]

Sign In for Pricing
View Details
Nicotinuric Acid-d4
TRC-N433502-2.5MG 2.5 mg

Nicotinuric Acid-d4

Sign In for Pricing
View Details
Serum Amyloid P (APCS) Human Gene Knockout Kit (CRISPR)
KN202802BN 1 Kit

Serum Amyloid P (APCS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD73 (Immuno-Oncology Target) (NT5E/2503), CF647 conjugate, 0.1mg/mL
BNC472503-100 1x 100 µL

CD73 (Immuno-Oncology Target) (NT5E/2503), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (FN1) Mouse Monoclonal Antibody [Clone ID: SPM246]
AM50112PU-S 100 µg

Fibronectin (FN1) Mouse Monoclonal Antibody [Clone ID: SPM246]

Sign In for Pricing
View Details
NFIB / NF1B2 Mouse Monoclonal Antibody [1H2]
EM1701-67 100 µL

NFIB / NF1B2 Mouse Monoclonal Antibody [1H2]

Sign In for Pricing
View Details