Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMN1/2 Antibody

This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein. However, mutations in this gene, the telomeric copy, are associated with spinal muscular atrophy; mutations in the centromeric copy do not lead to disease. The centromeric copy may be a modifier of disease caused by mutation in the telomeric copy. The critical sequence difference between the two genes is a single nucleotide in exon 7, which is thought to be an exon splice enhancer. Note that the nine exons of both the telomeric and centromeric copies are designated historically as exon 1, 2a, 2b, and 3-8. It is thought that gene conversion events may involve the two genes, leading to varying copy numbers of each gene. The protein encoded by this gene localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs) . This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein. Multiple transcript variants encoding distinct isoforms have been described.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, IHC (FFPE) : 0.5-1 µg/mL, ICC: 0.5-1 µg/mL

UniProt

Q16637

Host

Mouse

Reactivity

Human

Immunogen

Amino acids RRGTGQSDDSDIWDDTALIKAYDKAVASFKH were used as the immunogen for the SMN1/2 antibody.

Clonality

Monoclonal

Isotype

IgG1

Clone

3D10

Applications

WB, IHC-P, ICC

Purity

Protein G affinity

Format

Purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the SMN1/2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This SMN1/2 antibody is available for research use only.

Storage Conditions

After reconstitution, the SMN1/2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the SMN1/2 antibody should be determined by the researcher.

Location

Nuclear, cytoplasmic

Image Legend

IHC testing of FFPE human breast cancer with SMN1/2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Parvg (NM_001162500) Mouse Tagged Lenti ORF Clone
MR219936L4 10 µg

Parvg (NM_001162500) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal C14orf28 Antibody
NBP2-55944-25ul 25 µL

Rabbit Polyclonal C14orf28 Antibody

Sign In for Pricing
View Details
Anti-Chlamydia trachomatis MOMP Antibody
15129-500 500ug

Anti-Chlamydia trachomatis MOMP Antibody

Sign In for Pricing
View Details
Recombinant Synechocystis sp. UPF0014 membrane protein slr1647 (slr1647)
MBS1263267 Inquire

Recombinant Synechocystis sp. UPF0014 membrane protein slr1647 (slr1647)

Sign In for Pricing
View Details
Colon Slides (Adult Adenocarcinoma, MSH)
NBP3-05684 5 Slides

Colon Slides (Adult Adenocarcinoma, MSH)

Sign In for Pricing
View Details
DNAJC13 CRISPR All-in-one AAV vector set (with saCas9)(Human)
18394151 3x 1.0 µg DNA

DNAJC13 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details