Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF9 Antibody

FGF 9, Fibroblast growth factor 9, is a protein that in humans is encoded by the FGF9 gene. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. The FGF 9 gene contains 3 exons. By radioactive chromosomal in situ hybridization, the FGF 9 gene is mapped to chromosome 13q11-q12. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P31371

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY were used as the immunogen for the FGF9 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the FGF9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This FGF9 antibody is available for research use only.

Storage Conditions

After reconstitution, the FGF9 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the FGF9 antibody should be determined by the researcher.

Location

Secreted

Image Legend

Western blot testing of 1) human COLO-320, 2) rat brain and 3) mouse brain lysate with FGF9 antibody at 0.5ug/ml. Predicted molecular weight ~23 kDa with a possible 45-55 kDa dimer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1A (Interleukin 1, alpha, IL-1A, IL1, IL1-ALPHA, IL1F1) (MaxLight 650)
MBS6228233-01 0.1 mL

IL1A (Interleukin 1, alpha, IL-1A, IL1, IL1-ALPHA, IL1F1) (MaxLight 650)

Sign In for Pricing
View Details
IL1A (Interleukin 1, alpha, IL-1A, IL1, IL1-ALPHA, IL1F1) (MaxLight 650)
MBS6228233-02 5x 0.1 mL

IL1A (Interleukin 1, alpha, IL-1A, IL1, IL1-ALPHA, IL1F1) (MaxLight 650)

Sign In for Pricing
View Details
LAMA5 Antibody
DF2380-01 100 µL

LAMA5 Antibody

Sign In for Pricing
View Details
LAMA5 Antibody
DF2380-02 200 µL

LAMA5 Antibody

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Breast Cancer Susceptibility Protein 2 (BRCA2)
MBS2054339-01 0.1 mL

HRP-Linked Polyclonal Antibody to Breast Cancer Susceptibility Protein 2 (BRCA2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Breast Cancer Susceptibility Protein 2 (BRCA2)
MBS2054339-02 0.2 mL

HRP-Linked Polyclonal Antibody to Breast Cancer Susceptibility Protein 2 (BRCA2)

Sign In for Pricing
View Details