Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGALS3BP Antibody / Galectin-3-binding protein

Galectin-3-binding protein is a protein that in humans is encoded by the LGALS3BP gene. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV) . It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL

UniProt

Q08380

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR from the human protein were used as the immunogen for the LGALS3BP antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the LGALS3BP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This LGALS3BP antibody is available for research use only.

Storage Conditions

After reconstitution, the LGALS3BP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the LGALS3BP antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HeLa, 2) COLO-320 and 3) mouse HEPA1-6 cell lysate with LGALS3BP antibody at 0.5ug/ml. Expected molecular weight: 65-90 kDa depending on glycosylation level.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IBP1 Antibody
8C20806-AAT 50 µg

IBP1 Antibody

Sign In for Pricing
View Details
Human Cytochrome P450 2A6 (CYP2A6) activation kit by CRISPRa
GA101093 1 Kit

Human Cytochrome P450 2A6 (CYP2A6) activation kit by CRISPRa

Sign In for Pricing
View Details
ACTHR Antibody
8G210-AAT 50 µg

ACTHR Antibody

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF640R conjugate, 0.1mg/mL
BNC402000-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ANXA3 Antibody
KC-1067-01 50 μL

ANXA3 Antibody

Sign In for Pricing
View Details
ANXA3 Antibody
KC-1067-02 100 µL

ANXA3 Antibody

Sign In for Pricing
View Details