Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TrkA Antibody

Neurotrophic tyrosine kinase receptor type 1, also called Trk-A, is a protein that in humans is encoded by the NTRK1 gene. The NTKR1 gene encodes the neurotrophic tyrosine kinase-1 receptor and belongs to a family of nerve growth factor receptors whose ligands include neurotrophins. This gene is mapped to 1q23.1. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, mental retardation and cancer.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P04629

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids EVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL from the human protein were used as the immunogen for the TrkA antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the TrkA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This TrkA antibody is available for research use only.

Storage Conditions

After reconstitution, the TrkA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the TrkA antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HeLa, 2) SGC-7901 and 3) THP-1 cell lysate with TrkA antibdoy at 0.5ug/ml. Expected molecular weight: 85~140 kDa depending on glycosylation level.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp786 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7523405 3x 1.0 µg

Zfp786 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
SELH/Selenoprotein H Rabbit pAb
E47R4458 100 µL

SELH/Selenoprotein H Rabbit pAb

Sign In for Pricing
View Details
Recombinant Human MFN2 Protein, N-His
orb3059234-01 50 µg

Recombinant Human MFN2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MFN2 Protein, N-His
orb3059234-02 100 µg

Recombinant Human MFN2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MFN2 Protein, N-His
orb3059234-03 1 mg

Recombinant Human MFN2 Protein, N-His

Sign In for Pricing
View Details
RASAL1 (RasGAP-activating-like Protein 1, RAS Protein Activator Like 1 (GAP1 Like) )
490104 100 µL

RASAL1 (RasGAP-activating-like Protein 1, RAS Protein Activator Like 1 (GAP1 Like) )

Sign In for Pricing
View Details