Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TrkA Antibody

Neurotrophic tyrosine kinase receptor type 1, also called Trk-A, is a protein that in humans is encoded by the NTRK1 gene. The NTKR1 gene encodes the neurotrophic tyrosine kinase-1 receptor and belongs to a family of nerve growth factor receptors whose ligands include neurotrophins. This gene is mapped to 1q23.1. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, mental retardation and cancer.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P04629

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids EVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL from the human protein were used as the immunogen for the TrkA antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the TrkA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This TrkA antibody is available for research use only.

Storage Conditions

After reconstitution, the TrkA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the TrkA antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HeLa, 2) SGC-7901 and 3) THP-1 cell lysate with TrkA antibdoy at 0.5ug/ml. Expected molecular weight: 85~140 kDa depending on glycosylation level.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL22RA2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1082106 1.0 µg DNA

IL22RA2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
rno-miR-455-3p Primers
MPR00710 150 µL / 10 µM

rno-miR-455-3p Primers

Sign In for Pricing
View Details
PLSCR4 antibody
FNab06562 100 µg

PLSCR4 antibody

Sign In for Pricing
View Details
Muscarinic Acetylcholine Receptor M2 (CHRM2) Chicken ELISA Kit
F1433 96 Tests

Muscarinic Acetylcholine Receptor M2 (CHRM2) Chicken ELISA Kit

Sign In for Pricing
View Details
Anti-BAK/BAK1 Antibody Picoband® (Dylight488 Conjugate)
PB9484-Dylight488 100 µg

Anti-BAK/BAK1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
MGAT3 (Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, GGNT3, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III, N-acetylglucosaminyltransferase III, GlcNAc-T III, GNT-III, FLJ43371, MGC141943, MGC142278) (Biotin)
129617-Biotin 100 µL

MGAT3 (Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, GGNT3, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III, N-acetylglucosaminyltransferase III, GlcNAc-T III, GNT-III, FLJ43371, MGC141943, MGC142278) (Biotin)

Sign In for Pricing
View Details