Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Factor V Antibody

Factor V is a protein of the coagulation system, rarely referred to as proaccelerin or labile factor. The gene for factor V is located on the first chromosome (1q23) . This gene encodes an essential cofactor of the blood coagulation cascade. This factor circulates in plasma, and is converted to the active form by the release of the activation peptide by thrombin during coagulation. This generates a heavy chain and a light chain which are held together by calcium ions. The activated protein is a cofactor that participates with activated coagulation factor X to activate prothrombin to thrombin. Defects in this gene result in either an autosomal recessive hemorrhagic diathesis or an autosomal dominant form of thrombophilia, which is known as activated protein C resistance.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

P12259

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids ESTVMATRKMHDRLEPEDEESDADYDYQNRLAAALGIR from the human protein were used as the immunogen for the Factor V antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the Factor V antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Factor V antibody is available for research use only.

Storage Conditions

After reconstitution, the Factor V antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Factor V antibody should be determined by the researcher.

Image Legend

Western blot testing of human plasma with Factor V antibody at 0.5ug/ml. Predicted molecular weight ~252 kDa.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYAR Antibody
MBS9605369-01 0.1 mL

LYAR Antibody

Sign In for Pricing
View Details
LYAR Antibody
MBS9605369-02 0.2 mL

LYAR Antibody

Sign In for Pricing
View Details
LYAR Antibody
MBS9605369-03 5x 0.2 mL

LYAR Antibody

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Kallikrein 1 (KLK1)
MBS2117143-01 1 mL

APC-Cy7 Linked Polyclonal Antibody to Kallikrein 1 (KLK1)

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Kallikrein 1 (KLK1)
MBS2117143-02 5 mL

APC-Cy7 Linked Polyclonal Antibody to Kallikrein 1 (KLK1)

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Kallikrein 1 (KLK1)
MBS2117143-03 5x 5 mL

APC-Cy7 Linked Polyclonal Antibody to Kallikrein 1 (KLK1)

Sign In for Pricing
View Details