Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RKIP Antibody / PEBP1 / PBP

PEBP1 (Phosphatidylethanolamine-binding protein 1), also called PBP, RKIP, inhibits the phosphorylation and activation of MEK by RAF1. PEBP1 is identical to the phosphatidylethanolamine-binding protein (PBP) with a relative molecular mass of 23 kD. The PEBP1 gene is mapped on 12q24.23. PEBP1 coimmunoprecipitates with RAF1 and MEK from cell lysates and colocalizes with RAF1 when examined by confocal microscopy. PEBP1 overexpression interferes with the activation of MEK and ERK, induction of AP1-dependent reporter genes, and transformation elicited by an oncogenically activated RAF1 kinase. PEBP1 expression was rapidly upregulated during induction of chemotherapy-triggered apoptosis in human prostate and breast cancer cell lines, and maximal RKIP expression correlated perfectly with the onset of apoptosis by Chatterjee et al (2004) . RKIP depletion decreased the mitotic index, the number of metaphase cells, traversal times from nuclear envelope breakdown to anaphase, and an override of mitotic checkpoints induced by spindle poisons.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

P30086

Host

Rabbit

Reactivity

Human, Mouse

Immunogen

Amino acids DHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQ were used as the immunogen for the RKIP antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the RKIP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This RKIP antibody is available for research use only.

Storage Conditions

After reconstitution, the RKIP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the RKIP antibody should be determined by the researcher.

Location

Cytoplasm

Image Legend

Western blot testing of human 1) HeLa, 2) placenta, 3) HepG2, 4) MCF7, 5) mouse testis and 6) mouse brain lysate with RKIP antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H4 Polyclonal Conjugated Antibody
MBS9449849-01 0.1 mL (Biotin)

Histone H4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Histone H4 Polyclonal Conjugated Antibody
MBS9449849-02 0.1 mL (AF350)

Histone H4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Histone H4 Polyclonal Conjugated Antibody
MBS9449849-03 0.1 mL (AF405)

Histone H4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Histone H4 Polyclonal Conjugated Antibody
MBS9449849-04 0.1 mL (AF488)

Histone H4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Histone H4 Polyclonal Conjugated Antibody
MBS9449849-05 0.1 mL (AF555)

Histone H4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Histone H4 Polyclonal Conjugated Antibody
MBS9449849-06 0.1 mL (AF594)

Histone H4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details