Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR3 Antibody

C-C chemokine receptor type 3, also called CCR3 or CKR3 is a protein that in humans is encoded by the CCR3 gene. The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5) . It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. Alternatively spliced transcript variants have been described.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, FACS: 1-3ug/10^6 cells

UniProt

P51677

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA were used as the immunogen for the CCR3 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the CCR3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This CCR3 antibody is available for research use only.

Storage Conditions

After reconstitution, the CCR3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the CCR3 antibody should be determined by the researcher.

Location

Cell membrane

Image Legend

Western blot testing of human 1) Jurkat, 2) HepG2, 3) MCF7, 4) U-87 MG, 5) CCRF-CEM, 6) rat brain, 7) mouse brain and 8) mouse testis lysate wtih CCR3 antibody at 0.5ug/ml. Expected molecular weight: 40~55 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MZF-1 Polyclonal Antibody
MBS8523940-01 0.1 mg

MZF-1 Polyclonal Antibody

Sign In for Pricing
View Details
MZF-1 Polyclonal Antibody
MBS8523940-02 0.1 mL (AF635)

MZF-1 Polyclonal Antibody

Sign In for Pricing
View Details
MZF-1 Polyclonal Antibody
MBS8523940-03 0.1 mL (AF610)

MZF-1 Polyclonal Antibody

Sign In for Pricing
View Details
MZF-1 Polyclonal Antibody
MBS8523940-04 0.1 mL (AF405S)

MZF-1 Polyclonal Antibody

Sign In for Pricing
View Details
MZF-1 Polyclonal Antibody
MBS8523940-05 0.1 mL (AF405L)

MZF-1 Polyclonal Antibody

Sign In for Pricing
View Details
MZF-1 Polyclonal Antibody
MBS8523940-06 0.1 mL (AF546)

MZF-1 Polyclonal Antibody

Sign In for Pricing
View Details