Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TORC2 Antibody / CRTC2

TORC2 (Transducer of CREB protein 2), also known as CRTC2, is a protein which in humans is encoded by the CRTC2 gene. This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of transcription coactivators. These proteins promote the transcription of genes targeted by the cAMP response element-binding protein, and therefore play an important role in many cellular processes. Under basal conditions the encoded protein is phosphorylated by AMP-activated protein kinase or the salt-inducible kinases and is sequestered in the cytoplasm. Upon activation by elevated cAMP or calcium, the encoded protein translocates to the nucleus and increases target gene expression. Single nucleotide polymorphisms in this gene may increase the risk of type 2 diabetes. A pseudogene of this gene is located on the long arm of chromosome 5.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q53ET0

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids EKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTR were used as the immunogen for the TORC2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the TORC2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This TORC2 antibody is available for research use only.

Storage Conditions

After reconstitution, the TORC2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the TORC2 antibody should be determined by the researcher.

Location

Cytoplasm

Image Legend

Western blot testing of human 1) HeLa, 2) MCF7 and 3) A375 cell lysate with TORC2 antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLOT1, NT (FLOT1, Flotillin-1) (MaxLight 405) discontinued
035690-ML405 100 µL

FLOT1, NT (FLOT1, Flotillin-1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
OsMt16 Rabbit pAb
orb2706214-01 50 µL

OsMt16 Rabbit pAb

Sign In for Pricing
View Details
OsMt16 Rabbit pAb
orb2706214-02 100 µL

OsMt16 Rabbit pAb

Sign In for Pricing
View Details
PU6-CDCA4 (human) -shRNA1-SV40-Puro
BZ47890 1 Vial

PU6-CDCA4 (human) -shRNA1-SV40-Puro

Sign In for Pricing
View Details
ZNFN1A5 (Zinc Finger Protein Pegasus, Ikaros Family Zinc Finger Protein 5, IKZF5) (Biotin)
MBS6145308-01 0.1 mL

ZNFN1A5 (Zinc Finger Protein Pegasus, Ikaros Family Zinc Finger Protein 5, IKZF5) (Biotin)

Sign In for Pricing
View Details
ZNFN1A5 (Zinc Finger Protein Pegasus, Ikaros Family Zinc Finger Protein 5, IKZF5) (Biotin)
MBS6145308-02 5x 0.1 mL

ZNFN1A5 (Zinc Finger Protein Pegasus, Ikaros Family Zinc Finger Protein 5, IKZF5) (Biotin)

Sign In for Pricing
View Details