Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFTPB Antibody / Pulmonary surfactant-associated protein B

Pulmonary surfactant-associated protein B is a protein that in humans is encoded by the SFTPB gene. This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

P07988

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids QCLAERYSVILLDTLLGRMLPQLVCRLVLR were used as the immunogen for the SFTPB antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the SFTPB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This SFTPB antibody is available for research use only.

Storage Conditions

After reconstitution, the SFTPB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the SFTPB antibody should be determined by the researcher.

Prediction Reactivity

Mouse, Rat

Image Legend

Western blot testing of human 1) MCF7, 2) COLO320 and 3) HepG2 cell lysate with SFTPB antibody at 0.5ug/ml. Predicted molecular weight ~42 kDa.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

T-Complex Protein 1 alpha (T Complex Protein 1 alpha Subunit, T Complex Protein 1 Subunit alpha, TCP1 alpha, TCP1-alpha, TCP-1 alpha, CCT 1, CCT1, CCT alpha, CCTa, D6S230E, T Complex 1, T-complex 1, T Complex Locus TCP1, T-complex Locus TCP-1, T Complex Protein 1, Tailless Complex Polypeptide 1, Tailless Complex Polypeptide 1A, TCP-1, TCP1) (MaxLight 750) discontinued
T2035-02D-ML750 100 µL

T-Complex Protein 1 alpha (T Complex Protein 1 alpha Subunit, T Complex Protein 1 Subunit alpha, TCP1 alpha, TCP1-alpha, TCP-1 alpha, CCT 1, CCT1, CCT alpha, CCTa, D6S230E, T Complex 1, T-complex 1, T Complex Locus TCP1, T-complex Locus TCP-1, T Complex Protein 1, Tailless Complex Polypeptide 1, Tailless Complex Polypeptide 1A, TCP-1, TCP1) (MaxLight 750) discontinued

Ask
View Details
μ-protocadherin siRNA (m)
sc-152486 10 µM

μ-protocadherin siRNA (m)

Ask
View Details
Gria4 (NM_001113181) Mouse Tagged Lenti ORF Clone
MR221619L3 10 µg

Gria4 (NM_001113181) Mouse Tagged Lenti ORF Clone

Ask
View Details
Mouse Monoclonal B7-1/CD80 Antibody (C80/1608) [DyLight 350]
NBP2-54307UV 100 µL

Mouse Monoclonal B7-1/CD80 Antibody (C80/1608) [DyLight 350]

Ask
View Details