Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASXL1 Antibody

Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL, Flow cytometry: 1-3ug/10^6 cells

UniProt

Q8IXJ9

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE were used as the immunogen for the ASXL1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the ASXL1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This ASXL1 antibody is available for research use only.

Storage Conditions

After reconstitution, the ASXL1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the ASXL1 antibody should be determined by the researcher.

Image Legend

Flow cytometry testing of human HepG2 cells with ASXL1 antibody at 1ug/10^6 cells (blocked with goat sera) ; Red=cells alone, Green=isotype control, Blue= ASXL1 antibody.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAOX, ID (PAOX, PAO, Peroxisomal N (1) -acetyl-spermine/spermidine oxidase, Polyamine oxidase) (APC) discontinued
039640-APC 200 µL

PAOX, ID (PAOX, PAO, Peroxisomal N (1) -acetyl-spermine/spermidine oxidase, Polyamine oxidase) (APC) discontinued

Sign In for Pricing
View Details
GRHL3 Antibody, FITC conjugated
MBS7050881-01 0.05 mg

GRHL3 Antibody, FITC conjugated

Sign In for Pricing
View Details
GRHL3 Antibody, FITC conjugated
MBS7050881-02 0.1 mg

GRHL3 Antibody, FITC conjugated

Sign In for Pricing
View Details
GRHL3 Antibody, FITC conjugated
MBS7050881-03 5x 0.1 mg

GRHL3 Antibody, FITC conjugated

Sign In for Pricing
View Details
TRMT2B antibody
70R-21005 50 μL

TRMT2B antibody

Sign In for Pricing
View Details
Bovine Acylamino-acid-releasing enzyme (APEH) ELISA Kit
MBS287294-01 48 Tests

Bovine Acylamino-acid-releasing enzyme (APEH) ELISA Kit

Sign In for Pricing
View Details