Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DC-SIGN Antibody / CD209

DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL

UniProt

Q9NNX6

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA were used as the immunogen for the DC-SIGN antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

IHC-P, WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the DC-SIGN antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This DC-SIGN antibody is available for research use only.

Storage Conditions

After reconstitution, the DC-SIGN antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the DC-SIGN antibody should be determined by the researcher.

Location

Cell membrane, secreted

Image Legend

IHC staining of FFPE human spleen tissue with DC-SIGN antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHCR7 Polyclonal Antibody
MBS2516627-01 0.02 mL

DHCR7 Polyclonal Antibody

Sign In for Pricing
View Details
DHCR7 Polyclonal Antibody
MBS2516627-02 0.06 mL

DHCR7 Polyclonal Antibody

Sign In for Pricing
View Details
DHCR7 Polyclonal Antibody
MBS2516627-03 0.12 mL

DHCR7 Polyclonal Antibody

Sign In for Pricing
View Details
DHCR7 Polyclonal Antibody
MBS2516627-04 0.2 mL

DHCR7 Polyclonal Antibody

Sign In for Pricing
View Details
PPPDE1/PNAS4 Peptide
DF12222-BP 1 mg

PPPDE1/PNAS4 Peptide

Sign In for Pricing
View Details
pOTB7-TRIM56 Plasmid
PVT26933 2 µg

pOTB7-TRIM56 Plasmid

Sign In for Pricing
View Details