Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DQB1 Antibody

Major histocompatibility complex, class II, DQ beta 1, also known as HLA-DQB1, is a human gene and also denotes the genetic locus that contains this gene. HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages) . The beta chain is approximately 26-28 kDa and it contains six exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. Alternative splicing results in multiple transcript variants.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL, Immunofluorescence: 5 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL

UniProt

P01920

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids DAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR were used as the immunogen for the HLA-DQB1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IF, IHC-P

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the HLA-DQB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This HLA-DQB1 antibody is available for research use only.

Storage Conditions

After reconstitution, the HLA-DQB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the HLA-DQB1 antibody should be determined by the researcher.

Image Legend

Immunofluorescent staining of FFPE human MCF7 cells with HLA-DQB1 antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nitric Oxide Colorimetric Detection Kit
9136 2x 96 Well Plate

Nitric Oxide Colorimetric Detection Kit

Sign In for Pricing
View Details
Beta-2-Microglobulin Antibody (HRP)
KH-2673-01 50 μL

Beta-2-Microglobulin Antibody (HRP)

Sign In for Pricing
View Details
Beta-2-Microglobulin Antibody (HRP)
KH-2673-02 100 µL

Beta-2-Microglobulin Antibody (HRP)

Sign In for Pricing
View Details
Beta-2-Microglobulin Antibody (HRP)
KH-2673-03 1 mL

Beta-2-Microglobulin Antibody (HRP)

Sign In for Pricing
View Details
USP7 Human Gene Knockout Kit (CRISPR)
KN213986 1 Kit

USP7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSPBP1 (NM_001130106) Human Over-expression Lysate
LC427167 20 µg

HSPBP1 (NM_001130106) Human Over-expression Lysate

Sign In for Pricing
View Details