Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA5 Antibody

Homeobox protein Hox-A5 is a protein that in humans is encoded the HOXA5 gene. In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

P20719

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids AQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEK from the human protein were used as the immunogen for the HOXA5 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the HOXA5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This HOXA5 antibody is available for research use only.

Storage Conditions

After reconstitution, the HOXA5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the HOXA5 antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) placenta and 2) HeLa cell lysate with HOXA5 antibody at 0.5ug/ml. Predicted molecular weight ~29 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aspergillus oryzae Probable rhamnogalacturonate lyase C (rglC), partial
MBS1343137 Inquire

Recombinant Aspergillus oryzae Probable rhamnogalacturonate lyase C (rglC), partial

Sign In for Pricing
View Details
Recombinant Murine RANTES/CCL5
P6780-5μg 5 μg

Recombinant Murine RANTES/CCL5

Sign In for Pricing
View Details
AAH1 Antibody
orb844245 2 mg

AAH1 Antibody

Sign In for Pricing
View Details
VEGFR2 antibody
70R-11546 100 ug

VEGFR2 antibody

Sign In for Pricing
View Details
C1ORF95 Rabbit pAb
E47R15081 100 µL

C1ORF95 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Pwwp3a shRNA (UAS) - Lentiviral mouse Pwwp3a shRNA (UAS, GFP) (100)
GTR15212169 1 Vial

Lentiviral mouse Pwwp3a shRNA (UAS) - Lentiviral mouse Pwwp3a shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details