Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL11 Antibody / KDM2A

Lysine-specific demethylase 2A (KDM2A) also known as F-box and leucine-rich repeat protein 11 (FBXL11) is an enzyme that in humans is encoded by the KDM2A gene. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least six highly degenerated leucine-rich repeats. This family member plays a role in epigenetic silencing. It nucleates at CpG islands and specifically demethylates both mono- and di-methylated lysine-36 of histone H3. Alternative splicing results in multiple transcript variants.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

Q9Y2K7

Host

Rabbit

Reactivity

Human, Mouse

Immunogen

Amino acids KRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQR from the human protein were used as the immunogen for the FBXL11 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the FBXL11 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This FBXL11 antibody is available for research use only.

Storage Conditions

After reconstitution, the FBXL11 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the FBXL11 antibody should be determined by the researcher.

Prediction Reactivity

Rat

Image Legend

Western blot testing of 1) mouse liver and 2) human A431 lysate with FBXL11 antibody at 0.5ug/ml. Predicted molecular weight ~133 kDa.

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF9 Protein Vector (Human) (pPM-C-HA)
20512021 500 ng

FGF9 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Toll Like Receptor 3 (Biotin)
550260 200 µL

Toll Like Receptor 3 (Biotin)

Sign In for Pricing
View Details
Nuclear Receptor Rev-ErbA alpha (Rev ErbA alpha, Rev-ErbA-alpha, Rev Erb alpha, Rev-Erb-alpha, Rev-erbalpha, Rev-ErbA, ErbA-related 1, EAR1, EAR-1, hRev, Nuclear Receptor Subfamily 1 Group D Member 1, NR1D1, Orphan Nuclear Receptor NR1D1, THRA1, Thyroid H
MBS619269-01 0.1 mg

Nuclear Receptor Rev-ErbA alpha (Rev ErbA alpha, Rev-ErbA-alpha, Rev Erb alpha, Rev-Erb-alpha, Rev-erbalpha, Rev-ErbA, ErbA-related 1, EAR1, EAR-1, hRev, Nuclear Receptor Subfamily 1 Group D Member 1, NR1D1, Orphan Nuclear Receptor NR1D1, THRA1, Thyroid H

Sign In for Pricing
View Details
Nuclear Receptor Rev-ErbA alpha (Rev ErbA alpha, Rev-ErbA-alpha, Rev Erb alpha, Rev-Erb-alpha, Rev-erbalpha, Rev-ErbA, ErbA-related 1, EAR1, EAR-1, hRev, Nuclear Receptor Subfamily 1 Group D Member 1, NR1D1, Orphan Nuclear Receptor NR1D1, THRA1, Thyroid H
MBS619269-02 5x 0.1 mg

Nuclear Receptor Rev-ErbA alpha (Rev ErbA alpha, Rev-ErbA-alpha, Rev Erb alpha, Rev-Erb-alpha, Rev-erbalpha, Rev-ErbA, ErbA-related 1, EAR1, EAR-1, hRev, Nuclear Receptor Subfamily 1 Group D Member 1, NR1D1, Orphan Nuclear Receptor NR1D1, THRA1, Thyroid H

Sign In for Pricing
View Details
Human EIF3M Pre-designed siRNA Set A
SI004859A 1 Each

Human EIF3M Pre-designed siRNA Set A

Sign In for Pricing
View Details
Staphylococcal Enterotoxin B (SEB)
S7965-35C-01 100 µg

Staphylococcal Enterotoxin B (SEB)

Sign In for Pricing
View Details