Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIN1 Antibody / NMDAR1 / NR1

Glutamate [NMDA] receptor subunit zeta-1 is a protein that in humans is encoded by the GRIN1 gene. The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

Q05586

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids FIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK from the human protein were used as the immunogen for the GRIN1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the GRIN1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This GRIN1 antibody is available for research use only.

Storage Conditions

After reconstitution, the GRIN1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the GRIN1 antibody should be determined by the researcher.

Image Legend

Western blot testing of rat brain lysate with GRIN1 antibody at 0.5ug/ml. Predicted molecular weight ~105 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tucatinib Hemiethanolate
TRC-T599930-100MG 100 mg

Tucatinib Hemiethanolate

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2954), CF405S conjugate, 0.1mg/mL
BNC042954-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2954), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Tspan 13 (TSPAN13) activation kit by CRISPRa
GA108993 1 Kit

Human Tspan 13 (TSPAN13) activation kit by CRISPRa

Sign In for Pricing
View Details
CD21 (CR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D3]
TA814107AM 100 µL

CD21 (CR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D3]

Sign In for Pricing
View Details
PRMT3 Rabbit Monoclonal Antibody [Clone ID: RAB-C372]
TA386469 200 µg

PRMT3 Rabbit Monoclonal Antibody [Clone ID: RAB-C372]

Sign In for Pricing
View Details
MMP3 (NM_002422) Human Recombinant Protein
TP720325L 500 µg

MMP3 (NM_002422) Human Recombinant Protein

Sign In for Pricing
View Details