Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mucin 2 Antibody

Mucin 2, also known as MUC2, is a protein that in humans is encoded by the MUC2 gene. This gene encodes a member of the mucin protein family. It is mapped to 11p15.5. Mucin 2 is particularly prominent in the gut where it is secreted from goblet cells in the epithelial lining into the lumen of the large intestine. There, mucin 2, along with small amounts of related-mucin proteins, polymerizes into a gel of which 80% by weight is oligosaccharide side-chains that are added as post-translational modifications to the mucin proteins. This gel provides an insoluble mucous barrier that serves to protect the intestinal epithelium. The primary function of the MUC2 gene product is to provide a protective barrier between the epithelial surfaces and the gut lumen. There is decreased expression of MUC2 in colonic cancer and defective polymerization of secreted mucin in ulcerative colitis.

Product Specifications

CAS Number

9007-83-4

Specifications

Immunohistochemistry (FFPE) : 2-5 µg/mL, Immunofluorescence: 5-7 µg/mL

UniProt

Q02817

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD from the human protein were used as the immunogen for the Mucin 2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

IHC-P, IF

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the Mucin 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Mucin 2 antibody is available for research use only.

Storage Conditions

After reconstitution, the Mucin 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Mucin 2 antibody should be determined by the researcher.

Location

Secreted

Image Legend

IHC testing of FFPE human rectal cancer tissue with Mucin-2 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/CY7-Linked Polyclonal Antibody to RAD51 Homolog (RAD51)
MBS2084582-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to RAD51 Homolog (RAD51)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to RAD51 Homolog (RAD51)
MBS2084582-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to RAD51 Homolog (RAD51)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to RAD51 Homolog (RAD51)
MBS2084582-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to RAD51 Homolog (RAD51)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to RAD51 Homolog (RAD51)
MBS2084582-04 1 mL

APC/CY7-Linked Polyclonal Antibody to RAD51 Homolog (RAD51)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to RAD51 Homolog (RAD51)
MBS2084582-05 5 mL

APC/CY7-Linked Polyclonal Antibody to RAD51 Homolog (RAD51)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to RAD51 Homolog (RAD51)
MBS2084582-06 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to RAD51 Homolog (RAD51)

Sign In for Pricing
View Details