Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tec Antibody

TEC (TEC Protein Tyrosine Kinase) is an enzyme that in humans is encoded by the TEC gene. The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. By fluorescence in situ hybridization, Sato et al. (1994) mapped the gene to 4p12, the same location reported for TXK. Mouse Tec is a non-receptor type protein-tyrosine kinase that is highly expressed in many hematopoietic cell lines. Hantschel et al. (2007) identified TEC kinase and BTK kinase as major binders of the tyrosine kinase inhibitor dasatinib, which is used for treatment of BCR/ABL-positive CML.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

P42680

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids HDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPK from the human protein were used as the immunogen for the Tec antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the Tec antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Tec antibody is available for research use only.

Storage Conditions

After reconstitution, the Tec antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Tec antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HeLa, 2) MCF7, 3) COLO320, 4) HepG2, 5) rat stomach, 6) mouse stomach and 7) mouse heart lysate with Tec antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Na-Fmoc-D-tryptophan 4-alkoxybenzyl alcohol resin
285650-01 1 g

Na-Fmoc-D-tryptophan 4-alkoxybenzyl alcohol resin

Sign In for Pricing
View Details
Na-Fmoc-D-tryptophan 4-alkoxybenzyl alcohol resin
285650-02 2 g

Na-Fmoc-D-tryptophan 4-alkoxybenzyl alcohol resin

Sign In for Pricing
View Details
Na-Fmoc-D-tryptophan 4-alkoxybenzyl alcohol resin
285650-03 5 g

Na-Fmoc-D-tryptophan 4-alkoxybenzyl alcohol resin

Sign In for Pricing
View Details
Ctnna1 3'UTR Luciferase Stable Cell Line
TU104503 1.0 mL

Ctnna1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ADA siRNA (Mouse)
MBS8208275-01 15 nmol

ADA siRNA (Mouse)

Sign In for Pricing
View Details
ADA siRNA (Mouse)
MBS8208275-02 30 nmol

ADA siRNA (Mouse)

Sign In for Pricing
View Details