Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX8 Antibody

Paired box gene 8, also known as PAX8, is a protein which in humans is encoded by the PAX8 gene. This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

Q06710

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids RKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQ from the human protein were used as the immunogen for the PAX8 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the PAX8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PAX8 antibody is available for research use only.

Storage Conditions

After reconstitution, the PAX8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PAX8 antibody should be determined by the researcher.

Image Legend

Western blot testing of human SW579 cell lysate with PAX8 antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa but also observed at 55-60 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORA73A ORF Vector (Human) (pORF)
ORF032766 1.0 µg DNA

SNORA73A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
N-tert-Butyloxycarbonyl Serotonin 2,3,4-tri-O-Acetyl-β-D-glucuronide Methyl Ester
165473 25 mg

N-tert-Butyloxycarbonyl Serotonin 2,3,4-tri-O-Acetyl-β-D-glucuronide Methyl Ester

Sign In for Pricing
View Details
PISD (Phosphatidylserine Decarboxylase Proenzyme, PSD, PSDC, PSSC, DJ858B16, dJ858B16.2) (MaxLight 750)
MBS6431719-01 0.1 mL

PISD (Phosphatidylserine Decarboxylase Proenzyme, PSD, PSDC, PSSC, DJ858B16, dJ858B16.2) (MaxLight 750)

Sign In for Pricing
View Details
PISD (Phosphatidylserine Decarboxylase Proenzyme, PSD, PSDC, PSSC, DJ858B16, dJ858B16.2) (MaxLight 750)
MBS6431719-02 5x 0.1 mL

PISD (Phosphatidylserine Decarboxylase Proenzyme, PSD, PSDC, PSSC, DJ858B16, dJ858B16.2) (MaxLight 750)

Sign In for Pricing
View Details
Nucleobindin 1 (NUCB1, CALNUC, NUC) (Azide Free) (PE)
N6935-01B-PE 100 µL

Nucleobindin 1 (NUCB1, CALNUC, NUC) (Azide Free) (PE)

Sign In for Pricing
View Details
CHFR (NM_001161346) Human Tagged ORF Clone
RC228984 10 µg

CHFR (NM_001161346) Human Tagged ORF Clone

Sign In for Pricing
View Details