Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUR1 Antibody / ABCC8

ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL, FACS: 1-3ug/10^6 cells

UniProt

Q09428

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA from the human protein were used as the immunogen for the SUR1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the SUR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This SUR1 antibody is available for research use only.

Storage Conditions

After reconstitution, the SUR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the SUR1 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) human placenta, 2) rat brain and 3) mouse brain lysate with SUR1 antibody at 0.5ug/ml. Predicted molecular weight ~177 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFPI Protein Vector (Mouse) (pPB-N-His)
PV237863 500 ng

TFPI Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Nori® Rabbit IgA ELISA Kit
GR144002 96 Well

Nori® Rabbit IgA ELISA Kit

Sign In for Pricing
View Details
Monkey Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit
MBS9388930-01 48 Well

Monkey Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit

Sign In for Pricing
View Details
Monkey Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit
MBS9388930-02 96 Well

Monkey Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit

Sign In for Pricing
View Details
Monkey Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit
MBS9388930-03 5x 96 Well

Monkey Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit

Sign In for Pricing
View Details
Monkey Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit
MBS9388930-04 10x 96 Well

Monkey Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit

Sign In for Pricing
View Details