Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAD1 / SMAD5 Antibody

SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-? superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.

Product Specifications

CAS Number

9007-83-4

UniProt

Q15797

Host

Rabbit

Immunogen

Amino acids KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK from the human protein were used as the immunogen for the SMAD1/5 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Format

Antigen affinity purified

Buffer

0.5mg/ml if reconstituted with 0.2ml sterile DI water

Reconstitution

After reconstitution, the SMAD1/5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This SMAD1/5 antibody is available for research use only.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LRP6 Pre-designed siRNA Set A
SI008869A 1 Each

Human LRP6 Pre-designed siRNA Set A

Sign In for Pricing
View Details
TYMS Recombinant Antibody, PE-Cy7 Conjugated
bsm-60680R-PE-Cy7 100 µL

TYMS Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
ANKRA2 Antibody
MBS9401621-01 0.1 mL

ANKRA2 Antibody

Sign In for Pricing
View Details
ANKRA2 Antibody
MBS9401621-02 5x 0.1 mL

ANKRA2 Antibody

Sign In for Pricing
View Details
Zfand3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6302008 1.0 µg DNA

Zfand3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Human YY2 Protein, N-His
YHA51301 100 μg

Recombinant Human YY2 Protein, N-His

Sign In for Pricing
View Details