Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKG2D Antibody

NKG2D is encoded by KLRK1 gene which is located in the NK-gene complex (NKC) situated on and chromosome 12 in humans. Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. This gene encodes a member of the NKG2 family. The encoded transmembrane protein is characterized by a type II membrane orientation (has an extracellular C terminus) and the presence of a C-type lectin domain. It binds to a diverse family of ligands that include MHC class I chain-related A and B proteins and UL-16 binding proteins, where ligand-receptor interactions can result in the activation of NK and T cells. The surface expression of these ligands is important for the recognition of stressed cells by the immune system, and thus this protein and its ligands are therapeutic targets for the treatment of immune diseases and cancers. Read-through transcription exists between this gene and the upstream KLRC4 (killer cell lectin-like receptor subfamily C, member 4) family member in the same cluster.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

P26718

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

Amino acids YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH from the human protein were used as the immunogen for the NKG2D antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the NKG2D antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This NKG2D antibody is available for research use only.

Storage Conditions

After reconstitution, the NKG2D antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the NKG2D antibody should be determined by the researcher.

Prediction Reactivity

Human

Image Legend

Western blot testing of 1) rat lymph, 2) rat spleen and 3) mouse thymus tissue lysate with NKG2D antibody at 0.5ug/ml. Predicted molecular weight ~25 kDa (unmodified), ~35 kDa (glycosylated) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRBP2 (Nuclear Receptor Binding Protein 2, DKFZp434P086, MGC138699, TRG16, pp9320) (PE)
249491-PE 100 µL

NRBP2 (Nuclear Receptor Binding Protein 2, DKFZp434P086, MGC138699, TRG16, pp9320) (PE)

Sign In for Pricing
View Details
RCOR3 Protein Vector (Rat) (pPM-C-His)
PV298625 500 ng

RCOR3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Human TM4SF1 HEK293T Stable Cell Line
PX-SCL0016 1 vial of 2x10^6 cells

Human TM4SF1 HEK293T Stable Cell Line

Sign In for Pricing
View Details
HMGA2 (N-Term) (Mouse) Rabbit pAb
MBS8556306-01 0.1 mL

HMGA2 (N-Term) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
HMGA2 (N-Term) (Mouse) Rabbit pAb
MBS8556306-02 0.1 mL (AF405L)

HMGA2 (N-Term) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
HMGA2 (N-Term) (Mouse) Rabbit pAb
MBS8556306-03 0.1 mL (AF405S)

HMGA2 (N-Term) (Mouse) Rabbit pAb

Sign In for Pricing
View Details