Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM1 Antibody

Glutathione S-transferase Mu 1 (gene name GSTM1) is a human glutathione S-transferase. Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL, Flow cytometry: 1-3ug/10^6 cells

UniProt

P09488

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK from the human protein were used as the immunogen for the GSTM1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Reconstitution

After reconstitution, the GSTM1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This GSTM1 antibody is available for research use only.

Storage Conditions

After reconstitution, the GSTM1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the GSTM1 antibody should be determined by the researcher.

Prediction Reactivity

Human

Image Legend

Western blot testing of 1) rat brain, 2) rat lung, 3) mouse stomach and 4) mouse kidney lysate with GSTM1 antibody at 0.5ug/ml. Predicted molecular weight ~26 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF863P Protein Vector (Human) (pPM-C-HA)
PV145828 500 ng

ZNF863P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
AdmiRa-mmu-miR-598-5p Virus
mm1478 250 µL

AdmiRa-mmu-miR-598-5p Virus

Sign In for Pricing
View Details
SIP1 Rabbit Polyclonal Antibody (BF405)
orb2460225 100 µL

SIP1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Metacaspase-6 (AMC6)
MBS1071401-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Metacaspase-6 (AMC6)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Metacaspase-6 (AMC6)
MBS1071401-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Metacaspase-6 (AMC6)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Metacaspase-6 (AMC6)
MBS1071401-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Metacaspase-6 (AMC6)

Sign In for Pricing
View Details