Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ace Antibody / Angiotensin I converting enzyme

Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

P09470

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

Amino acids AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR from the mouse protein were used as the immunogen for the Ace antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the Ace antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Ace antibody is available for research use only.

Storage Conditions

After reconstitution, the Ace antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Ace antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) mouse lung, 2) mouse testis, 3) mouse stomach and 4) rat lung tissue lysate with Ace antibody at 0.5ug/ml. Expected molecular weight 140-170 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IFNGR1 Protein (His Tag)
PKSM041060-01 10 µg

Recombinant Mouse IFNGR1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IFNGR1 Protein (His Tag)
PKSM041060-02 50 µg

Recombinant Mouse IFNGR1 Protein (His Tag)

Sign In for Pricing
View Details
Muscarinic Acetylcholine Receptor M3 (CHRM3) (3rd Cytopl. Dom) Rabbit Polyclonal Antibody
AP06826PU-N 50 µg

Muscarinic Acetylcholine Receptor M3 (CHRM3) (3rd Cytopl. Dom) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cdkn1b Mouse Gene Knockout Kit (CRISPR)
KN503059 1 Kit

Cdkn1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CAPN8 (NM_001143962) Human Over-expression Lysate
LC428425 20 µg

CAPN8 (NM_001143962) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF180 (NM_001288761) Human Tagged ORF Clone
RG237636 10 µg

ZNF180 (NM_001288761) Human Tagged ORF Clone

Sign In for Pricing
View Details