MIP-3 alpha/CCL20, Rhesus macaque (GST)
The MIP-3 alpha/CCL20 protein is part of the intercrine beta (CC chemokine) family and helps regulate immune cell migration and inflammation. It is thought to attract and activate dendritic cells and memory T cells, playing a crucial role in immune responses at sites of infection or inflammation. MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST) is the recombinant Rhesus Macaque-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST), Rhesus Macaque, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-rhesus-macaque-gst.html
Smiles
ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM
Molecular Formula
574182 (Gene_ID) Q8HYP6 (A27-M96) (Accession)
Molecular Weight
35.1 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog