Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exportin-5 Antibody (N-Terminal Region)

Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

Q9HAV4

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids 2-43 (AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK) were used as the immunogen for the Exportin-5 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the Exportin-5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Exportin-5 antibody is available for research use only.

Storage Conditions

After reconstitution, the Exportin-5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Exportin-5 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat testis, 2) mouse testis and 3) human HeLa lysate with Exportin-5 antibody at 0.5ug/ml. Predicted molecular weight ~136 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-, 1mL 30nm
GP-1102-30 1 mL

Colloidal Gold Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-, 1mL 30nm

Sign In for Pricing
View Details
Lysozyme Recombinant Rabbit monoclonal Antibody
HA750170 100 µL

Lysozyme Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]
AN00338P-01 50 Tests

PE/Elab Fluor® 594 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]
AN00338P-02 100 Tests

PE/Elab Fluor® 594 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]
AN00338P-03 2x 100 Tests

PE/Elab Fluor® 594 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]

Sign In for Pricing
View Details
Uaca Mouse Gene Knockout Kit (CRISPR)
KN518539 1 Kit

Uaca Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details