Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCP2 Antibody (Middle Region)

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP) . UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'.

Product Specifications

CAS Number

9007-83-4

Specifications

Western Blot: 0.5-1 µg/mL

UniProt

P55851

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids 134-170 (AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE) were used as the immunogen for the UCP2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Reconstitution

After reconstitution, the UCP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This UCP2 antibody is available for research use only.

Storage Conditions

After reconstitution, the UCP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the UCP2 antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat spleen, 2) rat heart, 3) rat brain, 4) mouse spleen, 5) mouse heart, 6) mouse brain and 7) human HeLa lysate with UCP2 antibody at 0.5ug/ml. Predicted molecular weight ~34 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tspan31 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4979406 1.0 µg DNA

Tspan31 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS810715 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Norethylmorphine
CS-ED-00969 1 Each

Norethylmorphine

Sign In for Pricing
View Details
Human PLXDC1 knockout cell line
ABC-KH11791 1 Vial

Human PLXDC1 knockout cell line

Sign In for Pricing
View Details
ZNF630 (NM_001037735) Human Tagged ORF Clone Lentiviral Particle
RC211336L4V 200 µL

ZNF630 (NM_001037735) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CNN1 (Calponin-1, Basic Calponin, Calponin H1, Smooth Muscle) discontinued
360004-01 50 µL

CNN1 (Calponin-1, Basic Calponin, Calponin H1, Smooth Muscle) discontinued

Sign In for Pricing
View Details